DOMAIN CREATIONS INC

ANNANDALE, VA 22003

CLASS A CONTRACTOR A RBC CBC HIC

general-contractorremodelingframingcarpentrydrywall-insulationmasonryconcretestuccoroofingsidingguttersgutter-guardswindowsglass-glazingpaintingpressure-washingchimney-fireplacehvacelectricalplumbingflooring
domain.comSign in to save to favorites

Is this your business?

Claim your profile to update info. Add keyword rankings for $25/mo.

Claim this profile

Request a quote

Reviews

No reviews yet. Be the first to share your experience.

Contractor and licensing FAQs

  • How do I verify a contractor is licensed?

    Start by asking the contractor directly for their license number and the issuing authority. Licensing is trade-specific: plumbers and HVAC mechanics are typically licensed through your state's plumbing and mechanical systems licensing board; electrical contractors are licensed through your state's electrical licensing authority; general construction contractors register with your state licensing board. You can look up license status online through your state's professional licensing bureau online or through your state's contractor registration database. Before any work begins, also ask for a current certificate of general liability insurance and workers' compensation coverage. Confirm the coverage limits are adequate for your project—at minimum $1 million in general liability. EdgeLocal profiles include ratings and direct contact info, but license verification must be confirmed directly with the contractor and the relevant state agency.

  • Should I get multiple quotes from contractors?

    Yes—always get at least two or three quotes before hiring any contractor for significant work. Multiple quotes let you compare price, scope, materials, and timeline, and help you spot outliers: a quote significantly lower than others may indicate missing scope or cut corners, while a much higher quote may not be justified. When collecting quotes, give each contractor a clear description of the project so you can make accurate comparisons. Ask each to break out labor and materials separately when possible, and confirm what's included: demolition, permits, materials, cleanup, and warranty. Ask for estimated start dates and project duration as well. Use EdgeLocal to quickly find several rated contractors in your area so you can start the quote process without extensive additional research.

Ad slot (configure Google AdSense)